Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: Q6AZJ8
RecName: Histone H2A
Begin-End: 21-91
Organism: Xenopus laevis
Interaction Mode:   

Sequence:
RAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRND
Structures of the domain Q6AZJ8 21-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3kxb X-ray 3.2 G 20-90 None


© NPIDB team 2003 - 2021

text