Pfam domain
Pfam family: CENP-T_C (PF15511.8)
Uniprot AC: Q6CMU6
RecName: Histone H4
Begin-End: 25-99
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
DNIQGITKPAIRRLARRGGVKRISGLIYEEVRNVLKTFLESVIRDAVTYTEHAKRKTVTS
LDVVYALKRQGRTLY
Structures of the domain Q6CMU6 25-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6uph X-ray 2.7 F 27-99 None
6uph X-ray 2.7 B 27-99 None


© NPIDB team 2003 - 2021

text