Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: Q6FI13
RecName: Histone H2A type 2-A
Begin-End: 11-91
Organism: Homo sapiens
Interaction Mode:   

Sequence:
ARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNA
ARDNKKTRIIPRHLQLAIRND
Structures of the domain Q6FI13 11-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6se0 X-ray 3.8 G 12-88 None
6se0 X-ray 3.8 C 13-88 None
6se6 X-ray 3.5 G 13-88 None
6y5d X-ray 4.1 S 15-89  H-Bb S-Bb 
6y5d X-ray 4.1 G 15-89  H-Bb S-Bb L-Bb 
6y5d X-ray 4.1 C 15-89  H-Bb S-Bb L-Bb 
6see X-ray 4.2 G 14-88 None
6sef X-ray 3.7 G 14-88 None
6seg X-ray 3.1 G 14-88 None


© NPIDB team 2003 - 2021

text