Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: Q6FI13
RecName: Histone H2A type 2-A
Begin-End: 17-91
Organism: Homo sapiens
Interaction Mode:   

Sequence:
SRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKK
TRIIPRHLQLAIRND
Structures of the domain Q6FI13 17-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6se6 X-ray 3.5 C 18-88 None
6y5d X-ray 4.1 O 17-89  H-Bb S-Bb L-Bb 
6see X-ray 4.2 C 18-88 None
6sef X-ray 3.7 C 18-88 None
6seg X-ray 3.1 C 18-88 None


© NPIDB team 2003 - 2021

text