Pfam domain
Pfam family: DEAD (PF00270.31)
Uniprot AC: Q6NZL1
RecName: DEAH (Asp-Glu-Ala-His) box polypeptide 37
Begin-End: 252-414
Organism: Mus musculus
Interaction Mode:   

Sequence:
AEEQAIMEAVAEHPIVIVCGETGSGKTTQVPQFLYEAGYSSEDSIIGVTEPRRVAAVAMS
QRVAKEMNLSHRVVSYQIRYEGNVTEETRIKFMTDGVLLKEIQKDFLLLKYKVVIIDEAH
ERSVYTDILLGLLSRIVALRAKRHLPLKLLIMSATLRVEDFTQ
Structures of the domain Q6NZL1 252-414
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6o16 X-ray 2.88 B 252-414 None
6o16 X-ray 2.88 A 252-414 None


© NPIDB team 2003 - 2021

text