Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: Q71DI3
RecName: Histone H3.2
Begin-End: 38-132
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAS
EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR
Structures of the domain Q71DI3 38-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6t7b X-ray 5.1 A 37-131  H-Bb S-Bb L-Bb 
6t7b X-ray 5.1 E 38-131  H-Bb L-Bb 
6y5d X-ray 4.1 Q 41-132  H-Bb H-Mj S-Bb L-Bb L-Mn 
6y5d X-ray 4.1 M 39-132  H-Bb S-Bb L-Bb L-Mn 
6y5d X-ray 4.1 A 39-132  H-Bb H-Mj S-Bb L-Bb L-Mn 
6y5d X-ray 4.1 E 39-132  H-Bb S-Bb L-Bb L-Mn 
7joa X-ray 3.3 E 38-131 None
7joa X-ray 3.3 A 37-131 None
7jo9 X-ray 3.3 A 37-131 None
7jo9 X-ray 3.3 E 38-131 None
3av1 X-ray 2.5 A 39-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3av1 X-ray 2.5 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5b0y X-ray 2.56 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5b0y X-ray 2.56 A 39-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6t7c X-ray 4 E 38-131  H-Bb L-Bb L-Mn 
6t7c X-ray 4 A 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6t7d X-ray 4.4 A 37-131  H-Bb S-Bb L-Bb 
6t7d X-ray 4.4 E 38-131  L-Bb 
6t79 X-ray 3.2 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6t79 X-ray 3.2 A 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6xjd X-ray 6.8 A 37-131  H-Bb H-Mj L-Bb L-Mn 
6xjd X-ray 6.8 E 37-131  H-Bb H-Mj L-Bb L-Mn 
6fml X-ray 4.34 M 40-131 None
6fml X-ray 4.34 Q 38-131 None
6t7a X-ray 3.7 E 38-131  H-Bb L-Bb L-Mn 
6t7a X-ray 3.7 A 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5b0z X-ray 1.99 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5b0z X-ray 1.99 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5b40 X-ray 3.33 E 41-131  H-Bb H-Mj 
5b40 X-ray 3.33 A 41-131  H-Bb H-Mj 
6y5e X-ray 3.15 E 39-132  H-Bb H-Mj S-Bb L-Bb L-Mn 
6y5e X-ray 3.15 A 39-132  H-Bb H-Mj S-Bb L-Bb L-Mn 
6x59 X-ray 2.98 A 37-131  H-Bb S-Bb L-Bb L-Mn 
6x59 X-ray 2.98 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6x5a X-ray 4.36 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6x5a X-ray 4.36 A 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text