Pfam domain
Pfam family: RNA_pol_Rpb2_7 (PF04560.22)
Uniprot AC: Q72HM5
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 1028-1104
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
GGQRFGEMEVWALEAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRV
LVKELQALALDVQTLDE
Structures of the domain Q72HM5 1028-1104
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6cuu X-ray 2.99 C 1028-1104 None


© NPIDB team 2003 - 2021

text