Pfam domain
Pfam family: RNA_pol_Rpb2_3 (PF04565.18)
Uniprot AC: Q72HM5
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 393-461
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
QFKDETNPLSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLI
TSLAAYARV
Structures of the domain Q72HM5 393-461
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6cuu X-ray 2.99 C 393-461  L-Bb 


© NPIDB team 2003 - 2021

text