Pfam domain
Pfam family: RNA_pol_Rpb1_5 (PF04998.19)
Uniprot AC: Q72HM6
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 1064-1304
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
GLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLF
QPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEI
QEVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHT
GGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGVVRIEETEEKLSVFVESEGFSKEY
K
Structures of the domain Q72HM6 1064-1304
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6cuu X-ray 2.99 D 1064-1253  H-Bb 


© NPIDB team 2003 - 2021

text