Pfam domain
Pfam family: RNA_pol_Rpb1_3 (PF04983.20)
Uniprot AC: Q72HM6
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 768-954
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
NLLSPASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFATPEEALAAHERGEVALNAPI
KVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRILFARIVA
EAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGI
TIGIDDA
Structures of the domain Q72HM6 768-954
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6cuu X-ray 2.99 D 768-954 None


© NPIDB team 2003 - 2021

text