Pfam domain
Pfam family: RNA_pol_Rpb6 (PF01192.24)
Uniprot AC: Q72ID6
RecName: DNA-directed RNA polymerase subunit omega
Begin-End: 8-75
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
KLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKE
LLTGRLVF
Structures of the domain Q72ID6 8-75
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x21 X-ray 3.32 E 8-75 None
6cuu X-ray 2.99 E 8-75 None
5x22 X-ray 3.35 E 8-75 None
5x22 X-ray 3.35 O 8-75 None


© NPIDB team 2003 - 2021

text