Pfam domain
Pfam family: DEAD (PF00270.31)
Uniprot AC: Q72KB4
RecName: Transcription-repair-coupling factor
Begin-End: 444-607
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
TPDQKRALEEVLRDLESPHPMDRLVSGDVGFGKTEVALRAAHRVVGHGAQVAFLVPTTLL
AEQHGKTFRERFQGLPVRVAVLSRFTPPKEEEAILKGLAEGTVDIVIGTHRLLQEDVRFR
DLGLLIVDEEHRFGVAQKERIRELKAEVDTLYLSATPIPRTLYS
Structures of the domain Q72KB4 444-607
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6m6b X-ray 4.1 M 444-607  H-Bb L-Bb 
6m6a X-ray 5 M 444-607 None


© NPIDB team 2003 - 2021

text