Pfam domain
Pfam family: Helicase_C (PF00271.33)
Uniprot AC: Q72KB4
RecName: Transcription-repair-coupling factor
Begin-End: 638-749
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
LLVREAILFELERGGKVFYVHDRVASIEARRRFLESLVPEARIGVVHGQMPESLIEETML
LFAEGAYDVLLATTIIEAGLDVPEANTILIERADRLGLATLYQLRGRVGRRE
Structures of the domain Q72KB4 638-749
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6m6b X-ray 4.1 M 638-749  L-Bb 
6m6a X-ray 5 M 638-749 None


© NPIDB team 2003 - 2021

text