Pfam domain
Pfam family: RNA_pol_Rpb2_3 (PF04565.18)
Uniprot AC: Q76ZP7
RecName: DNA-directed RNA polymerase 133 kDa polypeptide
Begin-End: 427-494
Organism: Vaccinia virus
Interaction Mode:   

Sequence:
RTHPHYSWMQNISIPRSVGFYPDQVKISKMFSVRKYHPSQYLYFCSSDVPERGPQVGLVS
QLSVLSSI
Structures of the domain Q76ZP7 427-494
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rie X-ray 3.1 B 427-494 None


© NPIDB team 2003 - 2021

text