Pfam domain
Pfam family: TetR_N (PF00440.25)
Uniprot AC: Q79VH8
RecName: Repressor of the high-affinity (Methyl) ammonium uptake system
Begin-End: 24-70
Organism: Corynebacterium glutamicum
Interaction Mode:   

Sequence:
ILDASAELFTRQGFATTSTHQIADAVGIRQASLYYHFPSKTEIFLTL
Structures of the domain Q79VH8 24-70
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gy3 X-ray 2.68 B 24-70  H-Bb H-Mj L-Bb L-Mj 
6gy3 X-ray 2.68 A 24-70  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text