Pfam domain
Pfam family: HTH_3 (PF01381.24)
Uniprot AC: Q7A224
RecName: Antitoxin HigA
Begin-End: 13-68
Organism: Proteus vulgaris
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
IARDLEDMGVSGRRFAHNIGVTPATVSRLLAGKTALTPSLSIRIAAALGSTPEFWL
Structures of the domain Q7A224 13-68
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6chv X-ray 2.9 D 13-68  H-Bb H-Mj L-Bb L-Mj 
6chv X-ray 2.9 B 13-68  H-Bb H-Mj L-Bb L-Mj 
6chv X-ray 2.9 A 13-68  H-Bb H-Mj L-Bb L-Mj 
6chv X-ray 2.9 C 13-68  H-Bb H-Mj L-Bb L-Mj 
6chv X-ray 2.9 G 13-68  H-Bb H-Mj L-Bb L-Mj 
6chv X-ray 2.9 H 13-68  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text