Pfam domain
Pfam family: Crl (PF07417.14)
Uniprot AC: Q7CR52
RecName: Sigma factor-binding protein Crl
Begin-End: 5-128
Organism: Salmonella typhimurium
Interaction Mode:   

Sequence:
SGHPKSRLIKKFTALGPYIREGQCEDNRFFFDCLAVCVNVKPAPEKREFWGWWMELEAQE
KRFTYRYQFGLFDKEGNWTVVPINETEVVERLEYTLREFHEKLRDLLISMELALEPSDDF
NDEP
Structures of the domain Q7CR52 5-128
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6omf X-ray 3.26 J 5-128 None


© NPIDB team 2003 - 2021

text