Pfam domain
Pfam family: HTH_48 (PF17906.3)
Uniprot AC: Q7JQ07
RecName: Mariner Mos1 transposase
Begin-End: 8-57
Organism: Drosophila mauritiana
Interaction Mode:   

Sequence:
KEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKKCERWFQRFKSGD
Structures of the domain Q7JQ07 8-57
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3hot X-ray 3.25 B 8-57  H-Bb H-Mj L-Bb 
3hot X-ray 3.25 A 8-57  H-Bb H-Mj L-Bb L-Mj 
5hoo X-ray 3.3 A 8-57  H-Bb H-Mj L-Bb L-Mj 
5hoo X-ray 3.3 B 8-57  H-Bb H-Mj L-Bb L-Mj 
3hos X-ray 3.5 B 8-57  H-Bb H-Mj L-Bb L-Mj 
3hos X-ray 3.5 A 8-57  H-Bb H-Mj L-Bb L-Mj 
4r79 X-ray 3.1 A 8-57  H-Bb H-Mj L-Bb 
4r79 X-ray 3.1 B 8-57  H-Bb H-Mj L-Bb 
4u7b X-ray 3.09 G 8-57  H-Bb H-Mj L-Bb 
4u7b X-ray 3.09 B 8-57  H-Bb L-Bb L-Mj 
4u7b X-ray 3.09 A 8-57  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text