Pfam domain
Pfam family: DEAD (PF00270.31)
Uniprot AC: Q7L014
RecName: Probable ATP-dependent RNA helicase DDX46
Begin-End: 396-570
Organism: Homo sapiens
Interaction Mode:   

Sequence:
TPIQTQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRSLEEGEGPIAVIMTPTR
ELALQITKECKKFSKTLGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSG
RVTNLRRVTYVVLDEADRMFDMGFEPQVMRIVDNVRPDRQTVMFSATFPRAMEAL
Structures of the domain Q7L014 396-570
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6y5q X-ray 7.1 p 396-570 None
6y53 X-ray 7.1 p 396-570 None


© NPIDB team 2003 - 2021

text