Pfam domain
Pfam family: Tnp_P_element (PF12017.10)
Uniprot AC: Q7M3K2
RecName: Transposable element P transposase
Begin-End: 114-318
Organism: Drosophila melanogaster
Interaction Mode:   

Sequence:
TLEYEMRRLEQQLRESQQLEESLRKIFTDTQIRILKNGGQRATFNSDDISTAICLHTAGP
RAYNHLYKKGFPLPSRTTLYRWLSDVDIKRGCLDVVIDLMDSDGVDDADKLCVLAFDEMK
VAAAFEYDSSADIVYEPSDYVQLAIVRGLKKSWKQPVFFDFNTRMDPDTLNNILRKLHRK
GYLVVAIVSDLGTGNQKLWTELGIS
Structures of the domain Q7M3K2 114-318
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6pe2 X-ray 4 G 116-319  H-Mn L-Bb 
6pe2 X-ray 4 A 115-318  H-Bb H-Mj H-Mn L-Bb 


© NPIDB team 2003 - 2021

text