Pfam domain
Pfam family: Tnp_P_element (PF12017.10)
Uniprot AC: Q7M3K2
RecName: Transposable element P transposase
Begin-End: 128-318
Organism: Drosophila melanogaster
Interaction Mode:   

Sequence:
ESQQLEESLRKIFTDTQIRILKNGGQRATFNSDDISTAICLHTAGPRAYNHLYKKGFPLP
SRTTLYRWLSDVDIKRGCLDVVIDLMDSDGVDDADKLCVLAFDEMKVAAAFEYDSSADIV
YEPSDYVQLAIVRGLKKSWKQPVFFDFNTRMDPDTLNNILRKLHRKGYLVVAIVSDLGTG
NQKLWTELGIS
Structures of the domain Q7M3K2 128-318
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6p5a X-ray 3.6 A 128-318  H-Mn 
6p5a X-ray 3.6 G 128-318  H-Mn 


© NPIDB team 2003 - 2021

text