Pfam domain
Pfam family: z-alpha (PF02295.19)
Uniprot AC: Q7T2M9
RecName: Interferon-inducible and double-stranded-dependent eIF-2kinase
Begin-End: 3-63
Organism: Carassius auratus
Interaction Mode:   

Sequence:
AETQMERKIIDFLRQNGKSIALTIAKEIGLDKSTVNRHLYNLQRSNQVFNSNEKPPVWDL
M
Structures of the domain Q7T2M9 3-63
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4kmf X-ray 1.7 A 3-63 None


© NPIDB team 2003 - 2021

text