Pfam domain
Pfam family: V-set (PF07686.19)
Uniprot AC: Q7TS98
RecName: Anti-colorectal carcinoma light chain
Begin-End: 28-129
Organism: Mus musculus
Interaction Mode:   

Sequence:
QSPSSMYASLGERVTITCKASQDINSYLSWFQQKPGKSPKTLIYRANRLVDGVPSRFSGS
GSGQDYSLTISSLEYEDMGIYYCLQYDEFPRTFGGGTKLEIK
Structures of the domain Q7TS98 28-129
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1i8m X-ray 2.1 L 6-107 None
1i8m X-ray 2.1 A 6-107 None


© NPIDB team 2003 - 2021

text