Pfam domain
Pfam family: DcpS_C (PF11969.10)
Uniprot AC: Q7Z2E3
RecName: Aprataxin
Begin-End: 181-292
Organism: Homo sapiens
Interaction Mode:  H-Bb L-Bb L-Mj 

Sequence:
WSQGLKISMQDPKMQVYKDEQVVVIKDKYPKARYHWLVLPWTSISSLKAVAREHLELLKH
MHTVGEKVIVDFAGSSKLRFRLGYHAIPSMSHVHLHVISQDFDSPCLKNKKH
Structures of the domain Q7Z2E3 181-292
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6cvo X-ray 2.4 B 167-278  L-Mj 
6cvo X-ray 2.4 A 167-278 None
6cvq X-ray 1.65 B 167-278  H-Bb L-Bb 
6cvq X-ray 1.65 A 167-278  H-Bb L-Bb 
4ndg X-ray 2.54 A 167-278  H-Bb L-Bb 
4ndg X-ray 2.54 B 167-278  H-Bb L-Bb 
4ndh X-ray 1.85 B 167-278  H-Bb L-Bb 
4ndh X-ray 1.85 A 167-278  H-Bb L-Bb 
4ndf X-ray 1.94 A 167-278  H-Bb L-Bb 
4ndf X-ray 1.94 B 167-278  H-Bb L-Bb 
4ndi X-ray 1.9 A 167-278  H-Bb L-Bb 
4ndi X-ray 1.9 B 167-278  H-Bb L-Bb 
6cvp X-ray 2 A 167-278  H-Bb L-Bb 
6cvp X-ray 2 B 167-278  H-Bb L-Bb 
6cvr X-ray 1.88 A 167-278  H-Bb L-Bb 
6cvr X-ray 1.88 B 167-278  H-Bb L-Bb 
6cvt X-ray 2.94 A 167-278  H-Bb L-Bb 
6cvt X-ray 2.94 B 167-278  H-Bb 
6cvs X-ray 2.11 A 167-278  H-Bb L-Bb 
6cvs X-ray 2.11 B 167-278  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text