Pfam domain
Pfam family: zf-C2HE (PF16278.7)
Uniprot AC: Q7Z2E3
RecName: Aprataxin
Begin-End: 297-354
Organism: Homo sapiens
Interaction Mode:  H-Bb L-Bb 

Sequence:
NTEYFLESQAVIEMVQEAGRVTVRDGMPELLKLPLRCHECQQLLPSIPQLKEHLRKHW
Structures of the domain Q7Z2E3 297-354
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6cvo X-ray 2.4 B 283-340 None
6cvo X-ray 2.4 A 283-339 None
6cvq X-ray 1.65 B 283-340  H-Bb 
6cvq X-ray 1.65 A 283-340  H-Bb L-Bb 
4ndg X-ray 2.54 A 283-341  H-Bb 
4ndg X-ray 2.54 B 283-340  H-Bb 
4ndh X-ray 1.85 B 283-340  H-Bb 
4ndh X-ray 1.85 A 283-340  H-Bb L-Bb 
4ndf X-ray 1.94 A 283-340  H-Bb L-Bb 
4ndf X-ray 1.94 B 283-340  H-Bb 
4ndi X-ray 1.9 A 283-340  H-Bb L-Bb 
4ndi X-ray 1.9 B 283-340  H-Bb 
6cvp X-ray 2 A 283-340  H-Bb 
6cvp X-ray 2 B 283-340  H-Bb 
6cvr X-ray 1.88 A 283-340  H-Bb L-Bb 
6cvr X-ray 1.88 B 283-340  H-Bb 
6cvt X-ray 2.94 A 283-340  H-Bb 
6cvt X-ray 2.94 B 283-339  H-Bb 
6cvs X-ray 2.11 A 283-340  H-Bb L-Bb 
6cvs X-ray 2.11 B 283-340  H-Bb 


© NPIDB team 2003 - 2021

text