Pfam domain
Pfam family: DNA_pol_A (PF00476.22)
Uniprot AC: Q7Z5Q5
RecName: DNA polymerase nu
Begin-End: 447-854
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 

Sequence:
KEEMEKTSALLGARLKELEQEAHFVAGERFLITSNNQLREILFGKLKLHLLSQRNSLPRT
GLQKYPSTSEAVLNALRDLHPLPKIILEYRQVHKIKSTFVDGLLACMKKGSISSTWNQTG
TVTGRLSAKHPNIQGISKHPIQITTPKNFKGKEDKILTISPRAMFVSSKGHTFLAADFSQ
IELRILTHLSGDPELLKLFQESERDDVFSTLTSQWKDVPVEQVTHADREQTKKVVYAVVY
GAGKERLAACLGVPIQEAAQFLESFLQKYKKIKDFARAAIAQCHQTGCVVSIMGRRRPLP
RIHAHDQQLRAQAERQAVNFVVQGSAADLCKLAMIHVFTAVAASHTLTARLVAQIHDELL
FEVEDPQIPECAALVRRTMESLEQVQALELQLQVPLKVSLSAGRSWGH
Structures of the domain Q7Z5Q5 447-854
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4xvl X-ray 3.3 A 447-854  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 
4xvm X-ray 3.2 A 447-854  H-Bb H-Mj H-Mn L-Bb L-Mj 
4xvi X-ray 3.1 A 447-854  H-Bb H-Mn L-Bb L-Mj L-Mn 
4xvk X-ray 2.95 A 447-854  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text