Pfam domain
Pfam family: Ribosomal_S8 (PF00410.21)
Uniprot AC: Q81VR6
RecName: 30S ribosomal protein S8
Begin-End: 5-132
Organism: Bacillus anthracis
Interaction Mode:   

Sequence:
DPIADMLTRIRNANMVRHEKLEVPASKIKKEIAELLKREGFIRDVEYIEDNKQGILRIFL
KYGANNERVITGLKRISKPGLRVYAKADEVPRVLNGLGIALVSTSKGVMTDKDARQLQTG
GEVVAYVW
Structures of the domain Q81VR6 5-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4pdb X-ray 2.6 A 28-155 None


© NPIDB team 2003 - 2021

text