Pfam domain
Pfam family: TetR_N (PF00440.25)
Uniprot AC: Q82H41
RecName: Putative gamma-butyrolactone receptor protein
Begin-End: 14-60
Organism: Streptomyces avermitilis
Interaction Mode:   

Sequence:
ILVAAAEVFDEVGYEAATISDVLKRSGVTKGALYFHFTSKQELAQAV
Structures of the domain Q82H41 14-60
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wpa X-ray 3.09 H 15-61 None
6wpa X-ray 3.09 D 15-61 None
6wpa X-ray 3.09 A 15-61 None
6wpa X-ray 3.09 E 15-61 None
6wpa X-ray 3.09 F 15-61 None
6wpa X-ray 3.09 B 15-61 None


© NPIDB team 2003 - 2021

text