Pfam domain
Pfam family: Endonuc-BglII (PF09195.13)
Uniprot AC: Q84AF2
RecName: BstYI
Begin-End: 11-202
Organism: Geobacillus stearothermophilus
Interaction Mode:  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mj 

Sequence:
NGLEYIQVHLPHIWEEIQEIIVSIDAEACRTKESKEKTKQGQILYSPVALNEAFKEKLEA
KGWKESRTNYYVTADPKLIRETLSLEPEEQKKVIEAAGKEALKSYNQTDFVKDRVAIEVQ
FGKYSFVAYDLFVKHMAFYVSDKIDVGVEILPMKELSKEMSSGISYYEGELYNVIRQGRG
VPAVPLVLIGIA
Structures of the domain Q84AF2 11-202
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1vrr X-ray 2.7 A 11-202  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mj 
1vrr X-ray 2.7 B 11-202  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mj 
2p0j X-ray 2.1 A 11-202  H-Bb H-Mj S-Bb L-Bb L-Mj 
2p0j X-ray 2.1 B 11-202  H-Bb S-Bb S-Mn L-Bb 


© NPIDB team 2003 - 2021

text