Pfam domain
Pfam family: DNA_photolyase (PF00875.20)
Uniprot AC: Q84KJ5
RecName: Cryptochrome DASH, chloroplastic/mitochondrial
Begin-End: 86-261
Organism: Arabidopsis thaliana
Interaction Mode:   

Sequence:
TILWFRNDLRVLDNDALYKAWSSSDTILPVYCLDPRLFHTTHFFNFPKTGALRGGFLMEC
LVDLRKNLMKRGLNLLIRSGKPEEILPSLAKDFGARTVFAHKETCSEEVDVERLVNQGLK
RVGNSTKLELIWGSTMYHKDDLPFDVFDLPDVYTQFRKSVEAKCSIRSSTRIPLSL
Structures of the domain Q84KJ5 86-261
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2vtb X-ray 2.01 B 42-217 None
2vtb X-ray 2.01 A 42-217 None
2vtb X-ray 2.01 D 42-217 None
2vtb X-ray 2.01 C 42-217 None
2vtb X-ray 2.01 F 42-217 None
2vtb X-ray 2.01 E 42-217 None


© NPIDB team 2003 - 2021

text