Pfam domain
Pfam family: z-alpha (PF02295.19)
Uniprot AC: Q86638
RecName: Double-stranded RNA-binding protein
Begin-End: 7-70
Organism: Vaccinia virus
Interaction Mode:   

Sequence:
DERSNAEIVCEAIKTIGIEGATAAQLTRQLNMEKREVNKALYDLQRSAMVYSSDDIPPRW
FMTT
Structures of the domain Q86638 7-70
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7c0i X-ray 2.4 C 7-70 None
7c0i X-ray 2.4 A 9-70 None
7c0i X-ray 2.4 B 7-69 None


© NPIDB team 2003 - 2021

text