Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.27)
Uniprot AC: Q875M3
RecName: RPS23
Begin-End: 31-144
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
KRLLGTAFKSSPFGGSSHAKGIVLEKIGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPND
GCLNFVDENDEVLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPR
Structures of the domain Q875M3 31-144
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 X 31-144 None


© NPIDB team 2003 - 2021

text