Pfam domain
Pfam family: Mab-21 (PF03281.16)
Uniprot AC: Q8C6L5
RecName: Cyclic GMP-AMP synthase
Begin-End: 200-495
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mn L-Bb L-Mn 

Sequence:
YYEHVKISAPNEFDVMFKLEVPRIELQEYYETGAFYLVKFKRIPRGNPLSHFLEGEVLSA
TKMLSKFRKIIKEEVKEIKDIDVSVEKEKPGSPAVTLLIRNPEEISVDIILALESKGSWP
ISTKEGLPIQGWLGTKVRTNLRREPFYLVPKNAKDGNSFQGETWRLSFSHTEKYILNNHG
IEKTCCESSGAKCCRKECLKLMKYLLEQLKKEFQELDAFCSYHVKTAIFHMWTQDPQDSQ
WDPRNLSSCFDKLLAFFLECLRTEKLDHYFIPKFNLFSQELIDRKSKEFLSKKIEY
Structures of the domain Q8C6L5 200-495
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4k96 X-ray 2.08 B 200-495  H-Bb L-Bb L-Mn 
4k96 X-ray 2.08 A 200-495  H-Bb L-Bb 
5xzg X-ray 1.83 A 200-495  H-Bb L-Bb L-Mn 
7joa X-ray 3.3 K 200-495 None
5n6i X-ray 3.6 B 200-495  H-Bb L-Bb 
5n6i X-ray 3.6 E 200-495  H-Bb L-Bb 
5n6i X-ray 3.6 C 200-495  H-Bb L-Bb 
5n6i X-ray 3.6 F 200-495  H-Bb L-Bb 
5n6i X-ray 3.6 A 200-495  H-Bb L-Bb 
5n6i X-ray 3.6 D 200-495  H-Bb L-Bb 
7jo9 X-ray 3.3 K 200-495 None
4k9a X-ray 2.26 A 200-495  H-Bb L-Bb 
4k99 X-ray 1.95 A 200-495  H-Bb L-Bb L-Mn 
4k9b X-ray 2.26 A 200-495  H-Bb L-Bb 
4k98 X-ray 1.94 A 200-495  H-Bb L-Bb L-Mn 
4k97 X-ray 2.41 A 200-495  H-Bb L-Bb 
4ley X-ray 2.5 B 200-495  H-Bb L-Bb 
4ley X-ray 2.5 D 200-495  H-Bb H-Mn L-Bb 
4ley X-ray 2.5 A 200-495  H-Bb L-Bb L-Mn 
4ley X-ray 2.5 C 200-495  H-Bb H-Mn L-Bb 
4o6a X-ray 1.86 B 200-495  H-Bb L-Bb L-Mn 
4o6a X-ray 1.86 A 200-495  H-Bb H-Mn L-Bb 
4lez X-ray 2.36 A 200-495  H-Bb H-Mn L-Bb 
4lez X-ray 2.36 C 200-495  H-Bb H-Mn L-Bb 
6xjd X-ray 6.8 L 200-495 None
6xjd X-ray 6.8 K 200-495 None
5xze X-ray 2.18 A 200-495  H-Bb L-Bb 
5xzb X-ray 2.13 A 200-495  H-Bb 
6x59 X-ray 2.98 K 200-495 None
6x5a X-ray 4.36 K 200-495 None
7a08 X-ray 3.11 a 200-495 None


© NPIDB team 2003 - 2021

text