Pfam domain
Pfam family: RVT_1 (PF00078.29)
Uniprot AC: Q8DMK2
RecName: Maturase reverse transcriptase
Begin-End: 119-326
Organism: Thermosynechococcus elongatus
Interaction Mode:   

Sequence:
IPKASGKQRPLGIPTTKDRAMQALYALALEPVAETTADRNSYGFRQGRCTADAAGQCFTV
LGRSDCAKYILDADITGCFDNISHEWLLDNIPLDKEVLRKWLKSGFVWKQQLFPTHAGTP
QGGVISPMLANMTLDGMEELLKKHLRKQKVNLIRYAGDFVVTGESKETLEKVTTVIQEFL
KERGLTLSEEKTKVVHIEEGFDFLGWNI
Structures of the domain Q8DMK2 119-326
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6me0 X-ray 3.6 C 119-326 None
6mec X-ray 3.6 C 119-326 None


© NPIDB team 2003 - 2021

text