Pfam domain
Pfam family: DNA_topoisoIV (PF00521.22)
Uniprot AC: Q8DPM2
RecName: DNA gyrase subunit A
Begin-End: 30-470
Organism: Streptococcus pneumoniae
Interaction Mode:   

Sequence:
RALPDVRDGLKPVHRRILYGMNELGVTPDKPHKKSARITGDVMGKYHPHGDSSIYEAMVR
MAQWWSYRYMLVDGHGNFGSMDGDSAAAQRYTEARMSKIALEMLRDINKNTVDFVDNYDA
NEREPLVLPARFPNLLVNGATGIAVGMATNIPPHNLGETIDAVKLVMDNPEVTTKDLMEV
LPGPDFPTGALVMGKSGIHKAYETGKGSIVLRSRTEIETTKTGRERIVVTEFPYMVNKTK
VHEHIVRLVQEKRIEGITAVRDESNREGVRFVIEVKRDASANVILNNLFKMTQMQTNFGF
NMLAIQNGIPKILSLRQILDAYIEHQKEVVVRRTRFDKEKAEARAHILEGLLIALDHIDE
VIRIIRASETDAEAQAELMSKFKLSERQSQAILDMRLRRLTGLERDKIQSEYDDLLALIA
DLADILAKPERVSQIIKDELD
Structures of the domain Q8DPM2 30-470
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4z2d X-ray 3.38 A 30-470  H-Bb H-Mj L-Bb L-Mj L-Mn 
4z2d X-ray 3.38 B 30-470  H-Bb H-Mj L-Bb L-Mj L-Mn 
4z2e X-ray 3.46 A 30-470  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
4z2e X-ray 3.46 B 30-470  H-Bb H-Mj L-Bb L-Mn 
4z2c X-ray 3.19 B 30-470  H-Bb H-Mj L-Bb L-Mj L-Mn 
4z2c X-ray 3.19 A 30-470  H-Bb L-Bb L-Mj L-Mn 
6n1p X-ray 6.35 G 30-470  H-Mn 
6n1p X-ray 6.35 H 30-470 None
6n1p X-ray 6.35 E 30-470 None
6n1p X-ray 6.35 F 30-470  L-Bb L-Mj 
6n1p X-ray 6.35 C 30-470 None
6n1p X-ray 6.35 D 30-470  L-Mj 
6n1p X-ray 6.35 A 30-470  H-Bb H-Mj H-Mn 
6n1p X-ray 6.35 B 30-470 None


© NPIDB team 2003 - 2021

text