Pfam domain
Pfam family: HTH_3 (PF01381.24)
Uniprot AC: Q8EIX4
RecName: Antitoxin HipB
Begin-End: 14-65
Organism: Shewanella oneidensis
Interaction Mode:   

Sequence:
IKERRKSAALTQDVAAMLCGVTKKTLIRVEKGEDVYISTVFKILDGLGIDIV
Structures of the domain Q8EIX4 14-65
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4pu3 X-ray 3.39 D 33-84  H-Bb H-Mj L-Bb L-Mj 
4pu3 X-ray 3.39 C 33-84  H-Bb L-Bb L-Mj 
4pu4 X-ray 3.79 C 34-85  H-Bb H-Mj L-Bb L-Mj 
4pu4 X-ray 3.79 D 34-85  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text