Pfam domain
Pfam family: SAD_SRA (PF02182.19)
Uniprot AC: Q8GZB6
RecName: Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4
Begin-End: 147-306
Organism: Arabidopsis thaliana
Interaction Mode:  H-Bb S-Bb L-Bb L-Mj L-Mn 

Sequence:
IIGDLPGIDVGHRFFSRAEMCAVGFHNHWLNGIDYMSMEYEKEYSNYKLPLAVSIVMSGQ
YEDDLDNADTVTYTGQGGHNLTGNKRQIKDQLLERGNLALKHCCEYNVPVRVTRGHNCKS
SYTKRVYTYDGLYKVEKFWAQKGVSGFTVYKYRLKRLEGQ
Structures of the domain Q8GZB6 147-306
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4qen X-ray 2 A 147-306  H-Bb S-Bb L-Bb L-Mj L-Mn 
4qep X-ray 3.1 A 147-306  H-Bb S-Bb L-Bb L-Mj L-Mn 
4qeo X-ray 2 A 147-306  H-Bb S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text