Pfam domain
Pfam family: S4 (PF01479.27)
Uniprot AC: Q8I3R0
RecName: 40S ribosomal protein S9, putative
Begin-End: 107-153
Organism: Plasmodium falciparum (isolate 3D7)
Interaction Mode:   

Sequence:
RRLQTKVFKLGLAKSVHHARVLIRQRHIRVGKQMVDIPSFLVRVDSE
Structures of the domain Q8I3R0 107-153
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6okk X-ray 3.3 E 107-153 None
3j7a X-ray 3.2 E 107-153 None


© NPIDB team 2003 - 2021

text