Pfam domain
Pfam family: Ribosomal_S10 (PF00338.24)
Uniprot AC: Q8IK02
RecName: 40S ribosomal protein S20e, putative
Begin-End: 21-114
Organism: Plasmodium falciparum (isolate 3D7)
Interaction Mode:   

Sequence:
IALTSKNLRAIEKVCSDIMKGAKEKNLNVSGPVRLPVKTLRITTRKSPCGEGTNTWDRFE
LRIYKRLIDLYSQCEVVTQMTSINIDPVVEVEVI
Structures of the domain Q8IK02 21-114
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6okk X-ray 3.3 N 21-114 None
3j7a X-ray 3.2 N 21-114 None


© NPIDB team 2003 - 2021

text