Pfam domain
Pfam family: RNA_pol (PF00940.21)
Uniprot AC: Q8LTE3
RecName: RNAP2
Begin-End: 4-151
Organism: Enterobacteria phage N4
Interaction Mode:   

Sequence:
FTAREYLKIDIANNYGLDKEDWDDRIAWFDKNENNLLNLVREAEEPALFYAGVKAWMDVK
EGKPIGYPVALDATSSGLQILACLTGDRRAAELCNVVNYRDESGKVKRRDAYTVIYNKML
NTLGKGARIKRNDCKQAIMTALYGSEAK
Structures of the domain Q8LTE3 4-151
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dt8 X-ray 3.2 B 4-151 None
6dta X-ray 2.69 B 4-151 None
6dt7 X-ray 2.5 B 4-151 None


© NPIDB team 2003 - 2021

text