Pfam domain
Pfam family: zf-CW (PF07496.17)
Uniprot AC: Q8NB78
RecName: Lysine-specific histone demethylase 1B
Begin-End: 138-191
Organism: Homo sapiens
Interaction Mode:   

Sequence:
YWVQCTKPECRKWRQLTKEIQLTPQIAKTYRCGMKPNTAIKPETSDHCSLPEDL
Structures of the domain Q8NB78 138-191
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6r25 X-ray 4.61 K 138-191 None
6r1u X-ray 4.36 K 138-191 None


© NPIDB team 2003 - 2021

text