Pfam domain
Pfam family: Amino_oxidase (PF01593.26)
Uniprot AC: Q8NB78
RecName: Lysine-specific histone demethylase 1B
Begin-End: 392-820
Organism: Homo sapiens
Interaction Mode:   

Sequence:
PAGLAAARQLHNFGIKVTVLEAKDRIGGRVWDDKSFKGVTVGRGAQIVNGCINNPVALMC
EQLGISMHKFGERCDLIQEGGRITDPTIDKRMDFHFNALLDVVSEWRKDKTQLQDVPLGE
KIEEIYKAFIKESGIQFSELEGQVLQFHLSNLEYACGSNLHQVSARSWDHNEFFAQFAGD
HTLLTPGYSVIIEKLAEGLDIQLKSPVQCIDYSGDEVQVTTTDGTGYSAQKVLVTVPLAL
LQKGAIQFNPPLSEKKMKAINSLGAGIIEKIALQFPYRFWDSKVQGADFFGHVPPSASKR
GLFAVFYDMDPQKKHSVLMSVIAGEAVASVRTLDDKQVLQQCMATLRELFKEQEVPDPTK
YFVTRWSTDPWIQMAYSFVKTGGSGEAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLS
GVREASKIA
Structures of the domain Q8NB78 392-820
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6r25 X-ray 4.61 K 392-820 None
6r1u X-ray 4.36 K 392-820 None


© NPIDB team 2003 - 2021

text