Pfam domain
Pfam family: TetR_N (PF00440.25)
Uniprot AC: Q8NMG3
RecName: Transcriptional regulator
Begin-End: 9-55
Organism: Corynebacterium glutamicum
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb 

Sequence:
ILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGM
Structures of the domain Q8NMG3 9-55
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2yvh X-ray 2.5 A 9-54  H-Bb H-Mj L-Bb 
2yvh X-ray 2.5 B 9-54  H-Bb H-Mj L-Bb 
2yvh X-ray 2.5 C 9-54  H-Bb H-Mj H-Mn L-Bb 
2yvh X-ray 2.5 D 9-54  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text