Pfam domain
Pfam family: DNA_photolyase (PF00875.20)
Uniprot AC: Q8PYK9
RecName: Deoxyribodipyrimidine photolyase
Begin-End: 21-184
Organism: Methanosarcina mazei
Interaction Mode:  L-Bb 

Sequence:
VVYWMSRDQRAEDNWALLFSRAIAKEANVPVVVVFCLTDEFLEAGIRQYEFMLKGLQELE
VSLSRKKIPSFFLRGDPGEKISRFVKDYNAGTLVTDFSPLRIKNQWIEKVISGISIPFFE
VDAHNVVPCWEASQKHEYAAHTFRPKLYALLPEFLEEFPELEPN
Structures of the domain Q8PYK9 21-184
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5zcw X-ray 2.7 B 21-184 None
5zcw X-ray 2.7 A 21-184  L-Bb 
2xrz X-ray 2.2 A 21-184 None
2xrz X-ray 2.2 B 21-185 None


© NPIDB team 2003 - 2021

text