Pfam domain
Pfam family: Methylase_S (PF01420.21)
Uniprot AC: Q8R9Q6
RecName: Restriction endonuclease S subunits
Begin-End: 211-381
Organism: Caldanaerobacter subterraneus subsp. tengcongensis
Interaction Mode:   

Sequence:
PPGWRWVRLGEVCDIIMGQSPPSSTYNFEGNGLPFFQGKADFGDLHPTPRIWCSAPQKVA
RPGDVLISVRAPVGSTNVANLACCIGRGLAALRPRDSLERFWLLYYLHYLEPELSKMGAG
STFNAITKKDLQNVFIPLPPLEEQRRIVAYLDQIQQQVAALKRAQAETEAE
Structures of the domain Q8R9Q6 211-381
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ybb X-ray 3.2 G 211-381 None
5ybb X-ray 3.2 D 211-381 None


© NPIDB team 2003 - 2021

text