Pfam domain
Pfam family: Methylase_S (PF01420.21)
Uniprot AC: Q8R9Q6
RecName: Restriction endonuclease S subunits
Begin-End: 9-187
Organism: Caldanaerobacter subterraneus subsp. tengcongensis
Interaction Mode:   

Sequence:
PPGWRWVRLGEVCLPTERRDPTKNPSTYFVYVDISAIDSTVGKIVSPKEILGQHAPSRAR
KVIRSGDVIFATTRPYLKNIALVPPDLDGQICSTGFCVIRANREFAEPEFLFHLCRSDFI
TNQLTASKMRGTSYPAVTDNDVYNTLIPLPPLEEQRRIVAKVEALMERVREVRRLRAEA
Structures of the domain Q8R9Q6 9-187
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ybb X-ray 3.2 G 9-187  H-Bb L-Bb L-Mj 
5ybb X-ray 3.2 D 9-187  H-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2021

text