Pfam domain
Pfam family: RNA_pol_Rpb6 (PF01192.24)
Uniprot AC: Q8RQE7
RecName: DNA-directed RNA polymerase subunit omega
Begin-End: 8-75
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
KLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKE
LLTGRLVF
Structures of the domain Q8RQE7 8-75
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4gzy X-ray 3.51 E 8-75 None
3aoh X-ray 4.1 E 8-75 None
3aoh X-ray 4.1 J 8-75 None
3aoh X-ray 4.1 O 8-75 None
2o5i X-ray 2.5 E 8-75 None
2o5i X-ray 2.5 O 8-75 None
3aoi X-ray 4.3 E 8-75 None
3aoi X-ray 4.3 O 8-75 None
3aoi X-ray 4.3 J 8-75 None
6kql X-ray 2.89 E 8-75 None
6l74 X-ray 3.12 E 8-75 None
2ppb X-ray 3 O 8-75 None
2ppb X-ray 3 E 8-75 None
2o5j X-ray 3 E 8-75 None
2o5j X-ray 3 O 8-75 None
6m6b X-ray 4.1 E 8-75 None
4oir X-ray 3.1 E 8-75 None
6lts X-ray 3.45 E 8-75 None
6kqg X-ray 2.78 E 8-75 None
4g7z X-ray 3.81 O 8-75 None
4g7z X-ray 3.81 E 8-75 None
4g7o X-ray 2.99 O 8-75 None
4g7o X-ray 2.99 E 8-75 None
4g7h X-ray 2.9 O 8-75 None
4g7h X-ray 2.9 E 8-75 None
4oiq X-ray 3.62 E 8-75 None
6p70 X-ray 3.05 E 8-75 None
4q4z X-ray 2.9 E 8-75 None
4q5s X-ray 3 E 8-75 None
4oin X-ray 2.8 E 8-75 None
4oip X-ray 3.4 E 8-75 None
6kqe X-ray 3.3 E 8-75 None
4oio X-ray 3.1 E 8-75 None
6ovr X-ray 2.84 E 8-75 None
5e17 X-ray 3.2 E 8-75 None
6ow3 X-ray 2.77 E 8-75 None
6kqn X-ray 3.49 E 8-75 None
5d4c X-ray 3.28 O 8-75 None
5d4c X-ray 3.28 E 8-75 None
5d4d X-ray 3 O 8-75 None
5d4d X-ray 3 E 8-75 None
5vo8 X-ray 3.3 E 8-75 None
6kqf X-ray 2.45 E 8-75 None
6p71 X-ray 2.92 E 8-75 None
4wqs X-ray 4.31 O 8-75 None
4wqs X-ray 4.31 E 8-75 None
5d4e X-ray 3.08 O 8-75 None
5d4e X-ray 3.08 E 8-75 None
6kqm X-ray 3.2 E 8-75 None
5e18 X-ray 3.3 E 8-75 None
6m6a X-ray 5 E 8-75 None
6kqh X-ray 3.18 E 8-75 None
4gzz X-ray 4.29 E 8-75 None
6oy7 X-ray 3.04 E 8-75 None
6ovy X-ray 3 E 8-75 None
5i2d X-ray 4.41 E 8-75 None
5i2d X-ray 4.41 P 8-75 None
6kqd X-ray 3.3 E 8-75 None
6kqd X-ray 3.3 O 8-75 None
6oy6 X-ray 3.1 E 8-75 None
5voi X-ray 2.8 E 8-75 None
6wox X-ray 3.14 E 8-75 None
6m6c X-ray 3.1 E 8-75 None
6woy X-ray 3 E 8-75 None


© NPIDB team 2003 - 2021

text