Pfam domain
Pfam family: RNA_pol_Rpb1_5 (PF04998.19)
Uniprot AC: Q8RQE8
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 1063-1421
Organism: Thermus thermophilus
Interaction Mode:  H-Bb 

Sequence:
EGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPL
FQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGE
IQEVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFH
TGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGVVRIEETEEKLSVFVESEGFSKE
YKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQGVK
LHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLL
Structures of the domain Q8RQE8 1063-1421
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4g7z X-ray 3.81 N 1064-1429  H-Bb 
4g7o X-ray 2.99 N 1064-1429  H-Bb 


© NPIDB team 2003 - 2021

text