Pfam domain
Pfam family: RNA_pol_Rpb1_5 (PF04998.19)
Uniprot AC: Q8RQE8
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 1064-1296
Organism: Thermus thermophilus
Interaction Mode:  H-Bb 

Sequence:
GLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISVPLF
QPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEI
QEVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHT
GGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGVVRIEETEEKLSVFVES
Structures of the domain Q8RQE8 1064-1296
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6oy5 X-ray 3.1 D 1064-1237  H-Bb 
4gzy X-ray 3.51 D 1064-1236 None
5x21 X-ray 3.32 D 1064-1284  H-Bb 
3aoh X-ray 4.1 D 1064-1253 None
3aoh X-ray 4.1 I 1064-1237 None
3aoh X-ray 4.1 N 1064-1253 None
2o5i X-ray 2.5 D 1064-1256  H-Bb 
2o5i X-ray 2.5 N 1064-1256  H-Bb 
3aoi X-ray 4.3 D 1064-1237 None
3aoi X-ray 4.3 N 1064-1237 None
3aoi X-ray 4.3 I 1064-1253 None
6kql X-ray 2.89 D 1064-1252  H-Bb 
6l74 X-ray 3.12 D 1064-1252  H-Bb 
2ppb X-ray 3 N 1064-1274  H-Bb L-Bb 
2ppb X-ray 3 D 1064-1274  H-Bb L-Bb 
6m6b X-ray 4.1 D 1064-1237 None
4oir X-ray 3.1 D 1064-1254  H-Bb 
6lts X-ray 3.45 D 1064-1252 None
6kqg X-ray 2.78 D 1064-1252  H-Bb 
4g7z X-ray 3.81 D 1064-1252  H-Bb 
4g7o X-ray 2.99 D 1064-1252  H-Bb 
4g7h X-ray 2.9 N 1064-1252  H-Bb 
4g7h X-ray 2.9 D 1064-1252  H-Bb 
4oiq X-ray 3.62 D 1064-1253  H-Bb 
6p70 X-ray 3.05 D 1064-1238  H-Bb 
4q4z X-ray 2.9 D 1064-1275  H-Bb 
4q5s X-ray 3 D 1064-1254  H-Bb 
4oin X-ray 2.8 D 1064-1252  H-Bb 
4oip X-ray 3.4 D 1064-1252 None
6kqe X-ray 3.3 D 1064-1252  H-Bb 
4oio X-ray 3.1 D 1064-1239 None
6ovr X-ray 2.84 D 1064-1237  H-Bb 
5e17 X-ray 3.2 D 1064-1252  H-Bb 
6ow3 X-ray 2.77 D 1064-1237  H-Bb 
6kqn X-ray 3.49 D 1064-1252  H-Bb 
5d4c X-ray 3.28 N 1064-1252  H-Bb 
5d4c X-ray 3.28 D 1064-1252  H-Bb 
5d4d X-ray 3 N 1064-1253  H-Bb 
5d4d X-ray 3 D 1064-1253  H-Bb 
5vo8 X-ray 3.3 D 1064-1237  H-Bb 
6kqf X-ray 2.45 D 1064-1252  H-Bb 
6p71 X-ray 2.92 D 1064-1284  H-Bb 
4wqs X-ray 4.31 N 1064-1286  H-Bb 
5d4e X-ray 3.08 N 1064-1252  H-Bb 
5d4e X-ray 3.08 D 1064-1252  H-Bb 
6kqm X-ray 3.2 D 1064-1252  H-Bb 
5e18 X-ray 3.3 D 1064-1252  H-Bb 
5x22 X-ray 3.35 D 1064-1284  H-Bb 
5x22 X-ray 3.35 N 1064-1284  H-Bb 
6m6a X-ray 5 D 1064-1236 None
6kqh X-ray 3.18 D 1064-1252  H-Bb 
4gzz X-ray 4.29 D 1064-1236 None
6oy7 X-ray 3.04 D 1064-1253  H-Bb 
6ovy X-ray 3 D 1064-1238  H-Bb 
5i2d X-ray 4.41 D 1064-1252 None
5i2d X-ray 4.41 O 1064-1252 None
6kqd X-ray 3.3 D 1064-1252  H-Bb 
6kqd X-ray 3.3 N 1064-1252  H-Bb 
6oy6 X-ray 3.1 D 1064-1237  H-Bb 
5voi X-ray 2.8 D 1064-1238  H-Bb 
6wox X-ray 3.14 D 1064-1254  H-Bb 
6m6c X-ray 3.1 D 1064-1237  H-Bb 
6woy X-ray 3 D 1064-1254  H-Bb 


© NPIDB team 2003 - 2021

text