Pfam domain
Pfam family: RNA_pol_Rpb1_1 (PF04997.14)
Uniprot AC: Q8RQE8
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 2-435
Organism: Thermus thermophilus
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
KKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACG
KYKRQRFEGKVCERCGVEVTKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSAT
ELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRELRYGKQETYPLPPGVDALVKD
GEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGEI
LAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKG
QPLAEAKGLLRMPRQVRAAQVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARV
EAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARVYPFEDDVEVSTGDRVAPGDVL
ADGGKVKSDVYGRV
Structures of the domain Q8RQE8 2-435
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2o5i X-ray 2.5 D 2-618  H-Bb H-Mj 
2o5i X-ray 2.5 N 2-618  H-Bb L-Bb 
2ppb X-ray 3 N 2-618  H-Bb L-Bb 
2ppb X-ray 3 D 2-618  H-Bb H-Mj L-Bb 
2o5j X-ray 3 D 2-618  H-Bb H-Mj L-Bb 
2o5j X-ray 3 N 2-618  L-Bb 
4wqs X-ray 4.31 N 2-618  L-Bb 


© NPIDB team 2003 - 2021

text